Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPH Rabbit Polyclonal Antibody (FITC)

PRPH Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NEF4, PRPH1

UniProt

P41219

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRPH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006253

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Component C8 (Complement C8, Complement Component C8 alpha Chain, Complement Component 8 alpha Polypeptide, Complement Component 8 Subunit alpha, C8A, Complement Component C8 beta Chain, Complement Component 8 beta Polypeptide, Complement Component 8 Subunit beta, C8B, Complement Component C8 gamma Chain, Complement Component 8 gamma Polypeptide, C8G, MGC142186, MGC163447) discontinued
137891 1 mL

Complement Component C8 (Complement C8, Complement Component C8 alpha Chain, Complement Component 8 alpha Polypeptide, Complement Component 8 Subunit alpha, C8A, Complement Component C8 beta Chain, Complement Component 8 beta Polypeptide, Complement Component 8 Subunit beta, C8B, Complement Component C8 gamma Chain, Complement Component 8 gamma Polypeptide, C8G, MGC142186, MGC163447) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal RPTOR Antibody [DyLight 350]
NB100-766UV 0.1 mL

Rabbit Polyclonal RPTOR Antibody [DyLight 350]

Sign In for Pricing
View Details
Lurasidone-d8 Hydrochloride
CS-O-06741 1 Each

Lurasidone-d8 Hydrochloride

Sign In for Pricing
View Details
COL4A3/Tumstatin Rabbit Polyclonal Antibody (BF647)
orb2453340 100 µL

COL4A3/Tumstatin Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Duck Long-Wave-Sensitive Opsin 1 (OPN1LW) ELISA Kit
MBS9922556 Inquire

Duck Long-Wave-Sensitive Opsin 1 (OPN1LW) ELISA Kit

Sign In for Pricing
View Details
Mouse Syk Antibody (Center)
E45R33244G-1 100 µL

Mouse Syk Antibody (Center)

Sign In for Pricing
View Details