Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubl3 Rabbit Polyclonal Antibody (FITC)

Ubl3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HCG, MUB, mmMUB, AW108023

UniProt

Q9Z2M6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ubl3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036038

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit
KTE61673-01 48 Tests

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit

Sign In for Pricing
View Details
Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit
KTE61673-02 96 Tests

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit

Sign In for Pricing
View Details
Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit
KTE61673-03 5x 96 Tests

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit

Sign In for Pricing
View Details
Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit
KTE61673-04 50x 96 Tests

Human Mediator of RNA polymerase II transcription subunit 1 (MED1) ELISA Kit

Sign In for Pricing
View Details
Recombinant C4A Antibody
RC-15643-01 50 μL

Recombinant C4A Antibody

Sign In for Pricing
View Details
Recombinant C4A Antibody
RC-15643-02 100 µL

Recombinant C4A Antibody

Sign In for Pricing
View Details