Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPRKB Rabbit Polyclonal Antibody (HRP)

TPRKB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI121, GAMOS5, CGI-121

UniProt

Q9Y3C4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TPRKB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH1B2 Human Gene Knockout Kit (CRISPR)
KN401313 1 Kit

PAFAH1B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EMR4P / GPR127 Rabbit Polyclonal Antibody
AP01313PU-N 100 µg

EMR4P / GPR127 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CKLF activation kit by CRISPRa
GA109638 1 Kit

Human CKLF activation kit by CRISPRa

Sign In for Pricing
View Details
PmL Protein (PmL) Human Gene Knockout Kit (CRISPR)
KN200700RB 1 Kit

PmL Protein (PmL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD117 (KIT/983), CF640R conjugate, 0.1mg/mL
BNC400983-500 1x 500 µL

CD117 (KIT/983), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Small Cell Lung Cancer (SCLC) (MOC-52), Biotin conjugate, 0.1mg/mL
BNCB0329-500 1x 500 µL

Small Cell Lung Cancer (SCLC) (MOC-52), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details