Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ak3 Rabbit Polyclonal Antibody (FITC)

Ak3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AK-, AK-3, Ak3l, Ak3l1, Akl3l, AA407498, AI506714

UniProt

Q9WTP7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067274

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf30 (C11orf30, Chromosome 11 Open Reading Frame 30, EMSY Protein, FLJ90741, GL002, Protein EMSY) discontinued
221210-01 50 µL

C11orf30 (C11orf30, Chromosome 11 Open Reading Frame 30, EMSY Protein, FLJ90741, GL002, Protein EMSY) discontinued

Sign In for Pricing
View Details
C11orf30 (C11orf30, Chromosome 11 Open Reading Frame 30, EMSY Protein, FLJ90741, GL002, Protein EMSY) discontinued
221210-02 100 µL

C11orf30 (C11orf30, Chromosome 11 Open Reading Frame 30, EMSY Protein, FLJ90741, GL002, Protein EMSY) discontinued

Sign In for Pricing
View Details
Olfactory receptor 10V1 discontinued
344866-01 100 µL

Olfactory receptor 10V1 discontinued

Sign In for Pricing
View Details
Olfactory receptor 10V1 discontinued
344866-02 200 µL

Olfactory receptor 10V1 discontinued

Sign In for Pricing
View Details
Human Ribonucleotide Reductase M2 (RRM2) ELISA Kit
MBS3802990-01 48 Well

Human Ribonucleotide Reductase M2 (RRM2) ELISA Kit

Sign In for Pricing
View Details
Human Ribonucleotide Reductase M2 (RRM2) ELISA Kit
MBS3802990-02 96 Well

Human Ribonucleotide Reductase M2 (RRM2) ELISA Kit

Sign In for Pricing
View Details