Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPC111 Rabbit Polyclonal Antibody (Biotin)

HSPC111 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSPC111, HSPC185

UniProt

Q9Y3C1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPC111

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057475

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Rat IgG (H&L) HRP
6908-250 250 µL

Goat Anti-Rat IgG (H&L) HRP

Sign In for Pricing
View Details
Recombinant Bartonella henselae ATP synthase subunit b 1 (atpF1)
orb2929814-01 20 µg

Recombinant Bartonella henselae ATP synthase subunit b 1 (atpF1)

Sign In for Pricing
View Details
Recombinant Bartonella henselae ATP synthase subunit b 1 (atpF1)
orb2929814-02 100 µg

Recombinant Bartonella henselae ATP synthase subunit b 1 (atpF1)

Sign In for Pricing
View Details
Anti-SSBP1 Antibody Picoband®, PE Conjugate
A05166-1-PE 100 µg/Vial

Anti-SSBP1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Human Defensin Alpha 5, Paneth Cell Specific (DEFa5) ELISA Kit
orb776542-01 48 Tests

Human Defensin Alpha 5, Paneth Cell Specific (DEFa5) ELISA Kit

Sign In for Pricing
View Details
Human Defensin Alpha 5, Paneth Cell Specific (DEFa5) ELISA Kit
orb776542-02 96 Tests

Human Defensin Alpha 5, Paneth Cell Specific (DEFa5) ELISA Kit

Sign In for Pricing
View Details