Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf29 Rabbit Polyclonal Antibody (HRP)

C2orf29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C40, C2orf29

UniProt

Q9UKZ1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf29

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_060016

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NCOA3 / Nuclear receptor coactivator 3 Recombinant Protein
R11290h 1 Each

Human NCOA3 / Nuclear receptor coactivator 3 Recombinant Protein

Sign In for Pricing
View Details
CHMP7 CRISPR Activation Plasmid (m)
sc-430602-ACT 20 µg

CHMP7 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
THEG5 (NM_001278576) Human Tagged ORF Clone
RG235985 10 µg

THEG5 (NM_001278576) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tau tubuLin kinase 2 (TTBK2) (NM_173500) Human Tagged Lenti ORF Clone
RC209688L2 10 µg

Tau tubuLin kinase 2 (TTBK2) (NM_173500) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TMEM247 CRISPR Activation Plasmid (h2)
sc-418171-ACT-2 20 µg

TMEM247 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
AGPHD1 Double Nickase Plasmid (h)
sc-417866-NIC 20 µg

AGPHD1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details