Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf29 Rabbit Polyclonal Antibody (HRP)

C2orf29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C40, C2orf29

UniProt

Q9UKZ1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf29

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_060016

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quick Step Human 5-lipoxygenase (5-LO/LOX) ELISA Kit
QS0030Hu-01 48 Tests

Quick Step Human 5-lipoxygenase (5-LO/LOX) ELISA Kit

Sign In for Pricing
View Details
Quick Step Human 5-lipoxygenase (5-LO/LOX) ELISA Kit
QS0030Hu-02 96 Tests

Quick Step Human 5-lipoxygenase (5-LO/LOX) ELISA Kit

Sign In for Pricing
View Details
MIR4679-2 Human MicroRNA Expression Plasmid (MI0017311)
SC401823 10 µg

MIR4679-2 Human MicroRNA Expression Plasmid (MI0017311)

Sign In for Pricing
View Details
AFP (alpha Fetoprotein) (FITC)
MBS6261963-01 0.1 mL

AFP (alpha Fetoprotein) (FITC)

Sign In for Pricing
View Details
AFP (alpha Fetoprotein) (FITC)
MBS6261963-02 5x 0.1 mL

AFP (alpha Fetoprotein) (FITC)

Sign In for Pricing
View Details
STAT6 (Signal Transducer and Activator of Transcription 6, IL-4 Stat) (MaxLight 490)
MBS6203559-01 0.1 mL

STAT6 (Signal Transducer and Activator of Transcription 6, IL-4 Stat) (MaxLight 490)

Sign In for Pricing
View Details