Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIWIL2 Rabbit Polyclonal Antibody (Biotin)

PIWIL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CT80, HILI, mili, PIWIL1L

UniProt

Q8TC59

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine A2b Receptor Blocking Peptide
MBS8218311-01 1 mg

Adenosine A2b Receptor Blocking Peptide

Sign In for Pricing
View Details
Adenosine A2b Receptor Blocking Peptide
MBS8218311-02 5 mg

Adenosine A2b Receptor Blocking Peptide

Sign In for Pricing
View Details
Adenosine A2b Receptor Blocking Peptide
MBS8218311-03 5x 5 mg

Adenosine A2b Receptor Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human SerpinA7 / TBG Protein (His tag)
ARP6913-01 10 µg

Recombinant Human SerpinA7 / TBG Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human SerpinA7 / TBG Protein (His tag)
ARP6913-02 50 µg

Recombinant Human SerpinA7 / TBG Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human SerpinA7 / TBG Protein (His tag)
ARP6913-03 100 µg

Recombinant Human SerpinA7 / TBG Protein (His tag)

Sign In for Pricing
View Details