Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMU1 Rabbit Polyclonal Antibody (HRP)

SMU1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BWD, SMU-1, fSAP57

UniProt

Q2TAY7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMU1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDPMIMLKQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060695

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Human IgE,  20nm
GM-19-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgE, 20nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS707387 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Dynamin 1 Recombinant Mouse Monoclonal Antibody [A1B1-R]
HA601230 100 µL

Dynamin 1 Recombinant Mouse Monoclonal Antibody [A1B1-R]

Sign In for Pricing
View Details
Dopamine Transporter Recombinant Chimeric Antibody Antibody
HA610244 100 µg

Dopamine Transporter Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
MYOD1 pSer200 Rabbit Polyclonal Antibody
AP02375PU-S 50 µL

MYOD1 pSer200 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CENPBD1P activation kit by CRISPRa
GA114243 1 Kit

Human CENPBD1P activation kit by CRISPRa

Sign In for Pricing
View Details