Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tuba8 Rabbit Polyclonal Antibody (HRP)

Tuba8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9JJZ2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADGTFGTQASKINDDDSFTTFFSETGNGKHVPRAVMVDLEPTVVDEVRAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059075

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXC11 Peptide (AAP31960)
AAP31960-100UG 100 µg

HOXC11 Peptide (AAP31960)

Sign In for Pricing
View Details
CD45, Recombinant, Human (PTPRC, Protein Tyrosine Phosphatase, Receptor Type C, B220, CD45, CD45R, GP180, LCA, L-CA, Leukocyte Common Antigen, LY5, T200)
MBS635951-01 0.05 mg

CD45, Recombinant, Human (PTPRC, Protein Tyrosine Phosphatase, Receptor Type C, B220, CD45, CD45R, GP180, LCA, L-CA, Leukocyte Common Antigen, LY5, T200)

Sign In for Pricing
View Details
CD45, Recombinant, Human (PTPRC, Protein Tyrosine Phosphatase, Receptor Type C, B220, CD45, CD45R, GP180, LCA, L-CA, Leukocyte Common Antigen, LY5, T200)
MBS635951-02 5x 0.05 mg

CD45, Recombinant, Human (PTPRC, Protein Tyrosine Phosphatase, Receptor Type C, B220, CD45, CD45R, GP180, LCA, L-CA, Leukocyte Common Antigen, LY5, T200)

Sign In for Pricing
View Details
Aff1 (NM_133919) Mouse Tagged Lenti ORF Clone
MR219346L4 10 µg

Aff1 (NM_133919) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRNAD7 3'UTR Luciferase Stable Cell Line
TU026714 1.0 mL

TRNAD7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-GATA-3 (Breast and Urothelial Marker) Monoclonal Antibody (Clone: GATA3/2444)
36-2372-20 20 µg

Anti-GATA-3 (Breast and Urothelial Marker) Monoclonal Antibody (Clone: GATA3/2444)

Sign In for Pricing
View Details