Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb1ip Rabbit Polyclonal Antibody (HRP)

Apbb1ip Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Apbb1ip

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001094047

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Polyclonal Chicken anti-Rat IgG (H+L) Secondary Antibody [PE/Cy5.5]
NB120-6838PECY55 0.5 mL

Chicken Polyclonal Chicken anti-Rat IgG (H+L) Secondary Antibody [PE/Cy5.5]

Sign In for Pricing
View Details
DLAT Rabbit Monoclonal Antibody [Clone ID: 23GB805]
TA424731S 20 µL

DLAT Rabbit Monoclonal Antibody [Clone ID: 23GB805]

Sign In for Pricing
View Details
TKTL2 Antibody, FITC conjugated
A68193-100UG 100 µg

TKTL2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Anti-PML Protein/Pml Antibody Picoband® (Dylight488 Conjugate)
A00093-2-Dylight488 100 µg

Anti-PML Protein/Pml Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Fc receptor-like protein 6 Antibody (Fluoro550)
orb3169279 100 µg

Fc receptor-like protein 6 Antibody (Fluoro550)

Sign In for Pricing
View Details
Human CLDN4 (Claudin 4) ELISA Kit
RE1449H-01 48 Tests

Human CLDN4 (Claudin 4) ELISA Kit

Sign In for Pricing
View Details