Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pcnp Rabbit Polyclonal Antibody (FITC)

Pcnp Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI647035, 1110018D06Rik, Pcnp

UniProt

Q6P8I4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001019793

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R3C Human shRNA Plasmid Kit (Locus ID 55012)
TR306217 1 Kit

PPP2R3C Human shRNA Plasmid Kit (Locus ID 55012)

Sign In for Pricing
View Details
Lentiviral mouse B3galt1 shRNA (UAS) - Lentiviral mouse B3galt1 shRNA (UAS, GFP) plasmid
GTR15253330 1 Vial

Lentiviral mouse B3galt1 shRNA (UAS) - Lentiviral mouse B3galt1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
pCMV-NFKBIA-3×HA-Neo Plasmid
PVT47914 2 µg

pCMV-NFKBIA-3×HA-Neo Plasmid

Sign In for Pricing
View Details
Zfp142 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4893805 3x 1.0 µg

Zfp142 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
BCL7B, CT (BCL7B, B Cell CLL/lymphoma 7 protein family member B, Allergen=Hom s 3) (MaxLight 750) discontinued
032472-ML750 100 µL

BCL7B, CT (BCL7B, B Cell CLL/lymphoma 7 protein family member B, Allergen=Hom s 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-TIS11D (H243) ZFP36L2 Antibody
A05565-1 100 µL

Anti-TIS11D (H243) ZFP36L2 Antibody

Sign In for Pricing
View Details