Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAMBPL1 Rabbit Polyclonal Antibody (HRP)

STAMBPL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AMSH-FP, AMSH-LP, ALMalpha, bA399O19.2

UniProt

Q96FJ0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STAMBPL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065850

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CuLlin 4B (CuL4B) (NM_003588) Human Recombinant Protein
TP306935M 100 µg

CuLlin 4B (CuL4B) (NM_003588) Human Recombinant Protein

Sign In for Pricing
View Details
Aff4 Mouse Gene Knockout Kit (CRISPR)
KN500958 1 Kit

Aff4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF488A conjugate, 0.1mg/mL
BNC882808-500 1x 500 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p62 Antibody SQSTM1 (phospho-S403)
F48757-0.08ML 0.08 mL

p62 Antibody SQSTM1 (phospho-S403)

Sign In for Pricing
View Details
CCDC27 Mouse Monoclonal Antibody [Clone ID: OTI1F8]
CF811190 100 µg

CCDC27 Mouse Monoclonal Antibody [Clone ID: OTI1F8]

Sign In for Pricing
View Details
ZNF860 (C-term) Rabbit Polyclonal Antibody
AP54731PU-N 400 µL

ZNF860 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details