Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP97 Rabbit Polyclonal Antibody (FITC)

CFAP97 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hmw, KIAA1430

UniProt

Q9P2B7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA1430

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NMGYLNSSPLSRRARSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065878

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TACI/TNFRSF13B/CVID Antibody [mFluor Violet 500 SE]
NBP1-76779MFV500 0.1 mL

Rabbit Polyclonal TACI/TNFRSF13B/CVID Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
ANIMAL LIFE HISTORIES Anopheles & Culex Comparative
4113500/11 1 Each

ANIMAL LIFE HISTORIES Anopheles & Culex Comparative

Sign In for Pricing
View Details
IFluor® A7 Anti-human CD1 Antibody *SN13*
100120S1-AAT 500 Tests

IFluor® A7 Anti-human CD1 Antibody *SN13*

Sign In for Pricing
View Details
Fra10ac1 (NM_001081075) Mouse Tagged ORF Clone Lentiviral Particle
MR219039L3V 200 µL

Fra10ac1 (NM_001081075) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bacteria Protease Inhibitor Cocktail (without EDTA), 100x Strength
BS380 1ml

Bacteria Protease Inhibitor Cocktail (without EDTA), 100x Strength

Sign In for Pricing
View Details
RNA Binding Protein Fox-1 Homolog 1 (RBFOX1) Antibody
abx321058-01 20 µL

RNA Binding Protein Fox-1 Homolog 1 (RBFOX1) Antibody

Sign In for Pricing
View Details