Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND1A Rabbit Polyclonal Antibody (Biotin)

DENND1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FAM31A, KIAA1608

UniProt

Q8TEH3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DENND1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1)
MBS625913-01 0.2 mL

PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1)

Sign In for Pricing
View Details
PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1)
MBS625913-02 5x 0.2 mL

PIAS1, CT E3 SUMO-protein Ligase PIAS1, Protein Inhibitor of Activated STAT Protein 1, Gu Binding Protein, GBP, RNA Helicase II Binding Protein, DEAD/H Box-binding Protein 1, DDXBP1)

Sign In for Pricing
View Details
Perilipin 3 (PLIN3) Antibody
abx173993 1 mL

Perilipin 3 (PLIN3) Antibody

Sign In for Pricing
View Details
Rabbit Anti CUL4B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC, Immunofluorescence)
MBS8423593 Inquire

Rabbit Anti CUL4B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(IHC, Immunofluorescence)

Sign In for Pricing
View Details
MTHFR Rabbit Polyclonal Antibody (BF555)
orb2511218 100 µL

MTHFR Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Human POLA2 qPCR Primer Pair
QH36305S 200 Tests

Human POLA2 qPCR Primer Pair

Sign In for Pricing
View Details