Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEAK7 Rabbit Polyclonal Antibody (HRP)

MEAK7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TLDC1, mEAK-7, KIAA1609

UniProt

Q6P9B6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA1609

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSAQENFQFDKMEVWAVGDPSEEQLAKGNKSILDADPEAQALLEISGHSR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_065998

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC4 CRISPR All-in-one AAV vector set (with saCas9)(Human)
37984151 3x 1.0 µg DNA

PSMC4 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
HEPACAM Antibody (C-term)
MBS9215177-01 0.08 mL

HEPACAM Antibody (C-term)

Sign In for Pricing
View Details
HEPACAM Antibody (C-term)
MBS9215177-02 0.4 mL

HEPACAM Antibody (C-term)

Sign In for Pricing
View Details
HEPACAM Antibody (C-term)
MBS9215177-03 5x 0.4 mL

HEPACAM Antibody (C-term)

Sign In for Pricing
View Details
Prr3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7380608 1.0 µg DNA

Prr3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CD11b (CD11 Antigen-like Family Member B, Cell Surface Glycoprotein MAC-1 Subunit alpha, CR-3 alpha Chain, CR3A, Integrin alpha-M, ITGAM, Leukocyte Adhesion Receptor MO1, MAC-1, MAC1A, MGC117044, MO1A, Neutrophil Adherence Receptor, SLEB6) discontinued
C2262-51C 1 mL

CD11b (CD11 Antigen-like Family Member B, Cell Surface Glycoprotein MAC-1 Subunit alpha, CR-3 alpha Chain, CR3A, Integrin alpha-M, ITGAM, Leukocyte Adhesion Receptor MO1, MAC-1, MAC1A, MGC117044, MO1A, Neutrophil Adherence Receptor, SLEB6) discontinued

Sign In for Pricing
View Details