Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIB3 Rabbit Polyclonal Antibody (HRP)

TRIB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NIPK, SINK, TRB3, SKIP3, C20orf97

UniProt

Q96RU7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIB3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_066981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD13D Protein Lysate (Human) with C-Ha Tag
11935031 100 µg

ANKRD13D Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Adenovirus, Hexon (MaxLight 650)
A0880-18A-ML650 100 µL

Adenovirus, Hexon (MaxLight 650)

Sign In for Pricing
View Details
TCF4 (NM_001243233) Human Untagged Clone
SC330103 10 µg

TCF4 (NM_001243233) Human Untagged Clone

Sign In for Pricing
View Details
ZNF313 (A-9) : m-IgG Fc BP-HRP Bundle
sc-540988 1 Kit

ZNF313 (A-9) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Substance P peptide
orb1097905 5 mg

Substance P peptide

Sign In for Pricing
View Details
Gm6310 3'UTR GFP Stable Cell Line
TU158389 1.0 mL

Gm6310 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details