Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nap1l2 Rabbit Polyclonal Antibody (Biotin)

Nap1l2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Bp, Bpx

UniProt

P51860

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Nap1l2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNND1 Recombinant Antibody, Cy5 Conjugated
bsm-60229R-Cy5 100 µL

CTNND1 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Anti-FABP6 Antibody Picoband®, Carrier-free
A07132-carrier-free 100 µg/Vial

Anti-FABP6 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Rel (Phospho-Ser503) Antibody
RDSA62024 100 µL

Rel (Phospho-Ser503) Antibody

Sign In for Pricing
View Details
Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit
MBS2706013-01 24 Strip Well

Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit

Sign In for Pricing
View Details
Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit
MBS2706013-02 48 Well

Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit

Sign In for Pricing
View Details
Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit
MBS2706013-03 96 Well

Human Purinergic Receptor P2Y, G Protein Coupled 12 (P2RY12) ELISA Kit

Sign In for Pricing
View Details