Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC1 Rabbit Polyclonal Antibody (HRP)

EXOC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SEC3, SEC3P, BM-102, SEC3L1

UniProt

Q9NV70

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEY

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_839955

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Aldo-keto reductase family 1 member C2 (AKR1C2) ELISA Kit
KTE60640-01 48 Tests

Human Aldo-keto reductase family 1 member C2 (AKR1C2) ELISA Kit

Sign In for Pricing
View Details
Human Aldo-keto reductase family 1 member C2 (AKR1C2) ELISA Kit
KTE60640-02 96 Tests

Human Aldo-keto reductase family 1 member C2 (AKR1C2) ELISA Kit

Sign In for Pricing
View Details
Human Aldo-keto reductase family 1 member C2 (AKR1C2) ELISA Kit
KTE60640-03 5x 96 Tests

Human Aldo-keto reductase family 1 member C2 (AKR1C2) ELISA Kit

Sign In for Pricing
View Details
Human Aldo-keto reductase family 1 member C2 (AKR1C2) ELISA Kit
KTE60640-04 50x 96 Tests

Human Aldo-keto reductase family 1 member C2 (AKR1C2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Histone transcription regulator slm9 (slm9), partial
MBS1197270 Inquire

Recombinant Schizosaccharomyces pombe Histone transcription regulator slm9 (slm9), partial

Sign In for Pricing
View Details
Monkey Heparan sulfate glucosamine 3 O sulfotransferase 3A1 (HS3ST3A1) ELISA kit
GTR10448457 96 Well

Monkey Heparan sulfate glucosamine 3 O sulfotransferase 3A1 (HS3ST3A1) ELISA kit

Sign In for Pricing
View Details