Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKM2 Rabbit Polyclonal Antibody (Biotin)

PKM2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PK3, TCB, p58, OIP3, PKM2, CTHBP, THBP1, HEL-S-30

UniProt

P11980

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PKM2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002645

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ipo11 Mouse qPCR Primer Pair (NM_029665)
MP206502 200 Reactions

Ipo11 Mouse qPCR Primer Pair (NM_029665)

Sign In for Pricing
View Details
MDM1 Antibody
orb1553897-01 50 μL

MDM1 Antibody

Sign In for Pricing
View Details
MDM1 Antibody
orb1553897-02 100 µL

MDM1 Antibody

Sign In for Pricing
View Details
MDM1 Antibody
orb1553897-03 200 µL

MDM1 Antibody

Sign In for Pricing
View Details
Lentiviral human DESI1 shRNA (UAS) - Lentiviral human DESI1 shRNA (UAS) plasmid
GTR15330130 1 Vial

Lentiviral human DESI1 shRNA (UAS) - Lentiviral human DESI1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
IREB2, ID (Iron-responsive element-binding Protein 2, IRE-BP 2, Iron Regulatory Protein 2, IRP2)
MBS6013026-01 0.05 mg

IREB2, ID (Iron-responsive element-binding Protein 2, IRE-BP 2, Iron Regulatory Protein 2, IRP2)

Sign In for Pricing
View Details