Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAPC5 Rabbit Polyclonal Antibody (HRP)

SNAPC5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SNAP19

UniProt

O75971

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006040

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS20 Protein Vector (Mouse) (pPB-C-His)
PV225626 500 ng

RPS20 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513)
MBS7035894-01 0.02 mg

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513)
MBS7035894-02 0.1 mg

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513)
MBS7035894-03 5x 0.1 mg

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R513 (MIMI_R513)

Sign In for Pricing
View Details
OLIG3 Human Pre-designed siRNA Set A
HY-RS09779 1 Set

OLIG3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
PTEN (Phosphatase and Tensin Homolog, 10q23del, BZS, MGC11227, MHAM, MMAC1, PTEN1, TEP1) (MaxLight 405) discontinued
250626-ML405 100 µL

PTEN (Phosphatase and Tensin Homolog, 10q23del, BZS, MGC11227, MHAM, MMAC1, PTEN1, TEP1) (MaxLight 405) discontinued

Sign In for Pricing
View Details