Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM31 Rabbit Polyclonal Antibody (HRP)

TRIM31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF, HCG1, HCGI, C6orf13

UniProt

Q9BZY9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAAL

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_008959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF405S conjugate, 0.1mg/mL
BNC041841-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protonex™ Red 780 acid
21185-AAT 1 mg

Protonex™ Red 780 acid

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF568 conjugate, 0.1mg/mL
BNC682039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tide Fluor™ 2 azide [TF2 azide]
2252-AAT 1 mg

Tide Fluor™ 2 azide [TF2 azide]

Sign In for Pricing
View Details
Recombinant Mouse IL1R1/CD121a Protein (His Tag)
PKSM041327-01 10 µg

Recombinant Mouse IL1R1/CD121a Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL1R1/CD121a Protein (His Tag)
PKSM041327-02 50 µg

Recombinant Mouse IL1R1/CD121a Protein (His Tag)

Sign In for Pricing
View Details