Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZHX3 Rabbit Polyclonal Antibody (HRP)

ZHX3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIX1

UniProt

Q9H4I2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZHX3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055850

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Deinococcus radiodurans Uncharacterized FtsK-like protein DR_0400 (DR_0400), partial
MBS1463066 Inquire

Recombinant Deinococcus radiodurans Uncharacterized FtsK-like protein DR_0400 (DR_0400), partial

Sign In for Pricing
View Details
Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody
abx015364-01 10 µg

Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody

Sign In for Pricing
View Details
Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody
abx015364-02 100 µg

Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody

Sign In for Pricing
View Details
Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody
abx015364-03 200 µg

Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody

Sign In for Pricing
View Details
Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody
abx015364-04 300 µg

Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody

Sign In for Pricing
View Details
Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody
abx015364-05 1 mg

Olfactory Receptor Family 2 Subfamily AK Member 2 (OR2AK2) Antibody

Sign In for Pricing
View Details