Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Skil Rabbit Polyclonal Antibody (HRP)

Skil Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, sno, Skir, SnoN, sno-

UniProt

Q3TB81

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EQVMQQKCTCDSTLEKDREAEYAAQLAELRQRLDHAEADRQELQDELRQE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034179

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), Biotin conjugate, 0.1mg/mL
BNCB2095-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tacc3 Mouse Gene Knockout Kit (CRISPR)
KN517125 1 Kit

Tacc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC35G2 (NM_001097600) Human Over-expression Lysate
LY420394 100 µg

SLC35G2 (NM_001097600) Human Over-expression Lysate

Sign In for Pricing
View Details
Ywhae Mouse Gene Knockout Kit (CRISPR)
KN519572 1 Kit

Ywhae Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD20/MS4A1 Protein (TrxA Tag)
PKSH030304 100 µg

Recombinant Human CD20/MS4A1 Protein (TrxA Tag)

Sign In for Pricing
View Details
DDX5 (C-term) Rabbit Polyclonal Antibody
AP14107PU-N 400 µL

DDX5 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details