Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT8B Rabbit Polyclonal Antibody (HRP)

WNT8B Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q93098

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human WNT8B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK4 Rabbit Polyclonal Antibody (FITC)
orb2081577 100 µL

CDK4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Chkb sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6771905 3x 1.0 µg

Chkb sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)
MBS2084254-01 0.1 mL

FITC-Linked Polyclonal Antibody to Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)
MBS2084254-02 0.2 mL

FITC-Linked Polyclonal Antibody to Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)
MBS2084254-03 0.5 mL

FITC-Linked Polyclonal Antibody to Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)
MBS2084254-04 1 mL

FITC-Linked Polyclonal Antibody to Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP)

Sign In for Pricing
View Details