Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF563 Rabbit Polyclonal Antibody (Biotin)

ZNF563 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8TA94

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ZNF563

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKFP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microtubule Associated Serine/Threonine Kinase 2 (MAST2) Magnetic Fluorescence Assay Kit
MBS2160864-01 96 Tests

Microtubule Associated Serine/Threonine Kinase 2 (MAST2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Microtubule Associated Serine/Threonine Kinase 2 (MAST2) Magnetic Fluorescence Assay Kit
MBS2160864-02 5x 96 Tests

Microtubule Associated Serine/Threonine Kinase 2 (MAST2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Microtubule Associated Serine/Threonine Kinase 2 (MAST2) Magnetic Fluorescence Assay Kit
MBS2160864-03 10x 96 Tests

Microtubule Associated Serine/Threonine Kinase 2 (MAST2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
RGD1310039 Protein Vector (Rat) (pPB-N-His)
PV299751 500 ng

RGD1310039 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Optic Atrophy 3 (OPA3)
MBS2067667-01 0.1 mL

FITC-Linked Polyclonal Antibody to Optic Atrophy 3 (OPA3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Optic Atrophy 3 (OPA3)
MBS2067667-02 0.2 mL

FITC-Linked Polyclonal Antibody to Optic Atrophy 3 (OPA3)

Sign In for Pricing
View Details