Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AFY Rabbit Polyclonal Antibody (FITC)

H2AFY Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

H2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1, macroH2A1.2

UniProt

O75367

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human H2AFY

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor markers PSA (hK2+) Not for the ELISA
EBS-T-229 100 μg

Tumor markers PSA (hK2+) Not for the ELISA

Sign In for Pricing
View Details
DRAM1 Antibody, HRP conjugated
MBS7050788-01 0.05 mg

DRAM1 Antibody, HRP conjugated

Sign In for Pricing
View Details
DRAM1 Antibody, HRP conjugated
MBS7050788-02 0.1 mg

DRAM1 Antibody, HRP conjugated

Sign In for Pricing
View Details
DRAM1 Antibody, HRP conjugated
MBS7050788-03 5x 0.1 mg

DRAM1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Slc2a7 (NM_001101020) Rat Tagged Lenti ORF Clone
RR201733L3 10 µg

Slc2a7 (NM_001101020) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bovine Major prion protein ELISA Kit
MBS2885607-01 48 Well

Bovine Major prion protein ELISA Kit

Sign In for Pricing
View Details