Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Usp27x Rabbit Polyclonal Antibody (HRP)

Usp27x Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sfc1, Sfc11, Usp27

UniProt

Q8CEG8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062334

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mertk Rat shRNA Plasmid (Locus ID 65037)
TL710890 1 Kit

Mertk Rat shRNA Plasmid (Locus ID 65037)

Sign In for Pricing
View Details
Chicken STUB1 / STIP1 homology and U box-containing protein 1 Recombinant Protein
R2375c 1 Each

Chicken STUB1 / STIP1 homology and U box-containing protein 1 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human DVL1 Protein, N-His-SUMO & C-Strep
orb2834087-01 20 µg

Recombinant Human DVL1 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Recombinant Human DVL1 Protein, N-His-SUMO & C-Strep
orb2834087-02 50 µg

Recombinant Human DVL1 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Recombinant Human DVL1 Protein, N-His-SUMO & C-Strep
orb2834087-03 100 µg

Recombinant Human DVL1 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
HDAC3 (Phospho-Ser424) Antibody
8A0939-AAT 50 µg

HDAC3 (Phospho-Ser424) Antibody

Sign In for Pricing
View Details