Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Usp27x Rabbit Polyclonal Antibody (HRP)

Usp27x Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sfc1, Sfc11, Usp27

UniProt

Q8CEG8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062334

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Mouse IgG+IgM+IgA Heavy and Light Chain Antibody (HRP)
orb1518991 0.5 mg

Goat Mouse IgG+IgM+IgA Heavy and Light Chain Antibody (HRP)

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Polyclonal Antibody
CAU32831-01 100 µL

Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Polyclonal Antibody

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Polyclonal Antibody
CAU32831-02 200 µL

Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Polyclonal Antibody

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Polyclonal Antibody
CAU32831-03 1 mL

Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Iduronate-2-Sulfatase (IDS)
SIPH471Ra01-01 10 µg

Recombinant Iduronate-2-Sulfatase (IDS)

Sign In for Pricing
View Details
Recombinant Iduronate-2-Sulfatase (IDS)
SIPH471Ra01-02 50 µg

Recombinant Iduronate-2-Sulfatase (IDS)

Sign In for Pricing
View Details