Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR1A Rabbit Polyclonal Antibody (Biotin)

ACTR1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARP1, Arp1A, CTRN1

UniProt

P61163

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACTR1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005727

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PHEX shRNA Plasmid
abx953505-01 150 µg

Human PHEX shRNA Plasmid

Sign In for Pricing
View Details
Human PHEX shRNA Plasmid
abx953505-02 300 µg

Human PHEX shRNA Plasmid

Sign In for Pricing
View Details
HBEGF (heparin-Binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL) (APC)
246935-APC 100 µL

HBEGF (heparin-Binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL) (APC)

Sign In for Pricing
View Details
Human Nuclear Receptor Related Protein 1 (NURR1) ELISA Kit
orb1664371-01 48 Tests

Human Nuclear Receptor Related Protein 1 (NURR1) ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Receptor Related Protein 1 (NURR1) ELISA Kit
orb1664371-02 96 Tests

Human Nuclear Receptor Related Protein 1 (NURR1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal ATIC Antibody (OTI1D2) [mFluor Violet 610 SE]
NBP2-70220MFV610 0.1 mL

Mouse Monoclonal ATIC Antibody (OTI1D2) [mFluor Violet 610 SE]

Sign In for Pricing
View Details