Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D13 Rabbit Polyclonal Antibody (Biotin)

TBC1D13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ10743, RP11-545E17.5

UniProt

Q5T270

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TBC1D13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060671

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OBP2A sgRNA CRISPR Lentivector (Human) (Target 2)
K1474203 1.0 µg DNA

OBP2A sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SOCS3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-24250R-BF647 100 µL

SOCS3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP), Recombinant, Rat, His-Tag
049572-01 10 µg

Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP), Recombinant, Rat, His-Tag
049572-02 50 µg

Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP), Recombinant, Rat, His-Tag
049572-03 100 µg

Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP), Recombinant, Rat, His-Tag
049572-04 200 µg

Nuclear Autoantigenic Sperm Protein, Histone Binding (NASP), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details