Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDAH2 Rabbit Polyclonal Antibody (Biotin)

DDAH2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

G6a, DDAH, NG30, DDAHII, HEL-S-277

UniProt

O95865

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDAH2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_039268

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPTY2D1 Human Over-expression Lysate
orb1375265 20 µg

SPTY2D1 Human Over-expression Lysate

Sign In for Pricing
View Details
Gns antibody
70R-8622 100 µL

Gns antibody

Sign In for Pricing
View Details
Lentiviral mouse Ccdc59 shRNA (UAS) - Lentiviral mouse Ccdc59 shRNA (UAS, RFP) plasmid
GTR15246373 1 Vial

Lentiviral mouse Ccdc59 shRNA (UAS) - Lentiviral mouse Ccdc59 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
IFT122 Protein Vector (Human) (pPM-C-HA)
PV020883 500 ng

IFT122 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Capsaicin Receptor (VR1, Transient receptor potential cation channel subfamily V member 1, TrpV1, osm-9-like TRP channel 1, OTRPC1, Vanilloid receptor 1, Vanilloid receptor type 1-like) (HRP)
C1078-05-HRP 100 µL

Capsaicin Receptor (VR1, Transient receptor potential cation channel subfamily V member 1, TrpV1, osm-9-like TRP channel 1, OTRPC1, Vanilloid receptor 1, Vanilloid receptor type 1-like) (HRP)

Sign In for Pricing
View Details
VEGF, Recombinant, Human, Animal Free (Vascular Endothelial Growth Factor121, VPF) discontinued
208711-01 2 µg

VEGF, Recombinant, Human, Animal Free (Vascular Endothelial Growth Factor121, VPF) discontinued

Sign In for Pricing
View Details