Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arsb Rabbit Polyclonal Antibody (HRP)

Arsb Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, As, As-, As1, Ast, As-1, As-1r, As-1s, As-1t, As1-r, As1-s, As1-t, Asr-1, Ast-1, AI480648, 1110007C02Rik

UniProt

P50429

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_033842

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azide-free ImmunoDiluent & Block, Ready-To-Use
NB365-35 30 mL

Azide-free ImmunoDiluent & Block, Ready-To-Use

Sign In for Pricing
View Details
Mouse B3galt5 Pre-designed siRNA Set B
SI101267B 1 Each

Mouse B3galt5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-IL-1RA Antibody (9N548)
TMAY-00304 100 µL

Anti-IL-1RA Antibody (9N548)

Sign In for Pricing
View Details
SCARB1 Protein Vector (Human) (pPB-N-His)
PV057486 500 ng

SCARB1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
R 87366
orb1701736-01 25 mg

R 87366

Sign In for Pricing
View Details
R 87366
orb1701736-02 50 mg

R 87366

Sign In for Pricing
View Details