Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Rabbit Polyclonal Antibody (HRP)

UCHL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NDGOA, PARK5, PGP95, SPG79, PGP9.5, Uch-L1, HEL-117, PGP 9.5, HEL-S-53

UniProt

P09936

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UCHL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004172

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat IgG (H&L) Antibody - Texas Red Conjugated
OARA05520-2MG 2 mg

Goat IgG (H&L) Antibody - Texas Red Conjugated

Sign In for Pricing
View Details
Ddx24 (NM_001159502) Mouse Tagged ORF Clone Lentiviral Particle
MR210970L4V 200 µL

Ddx24 (NM_001159502) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
21-Desacetoxy Anecortave
TRC-D281865-100MG 100 mg

21-Desacetoxy Anecortave

Sign In for Pricing
View Details
MTCH1 3'UTR Luciferase Stable Cell Line
TU014855 1.0 mL

MTCH1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Fungus (1-3) -β-D-Glucan Detection Kit (CLIA)
BGCLIA-01 50-200 kits

Fungus (1-3) -β-D-Glucan Detection Kit (CLIA)

Sign In for Pricing
View Details
MFluor™ UV375 Anti-mouse CD26 Antibody *H194-112*
102600X0-AAT 100 Tests

MFluor™ UV375 Anti-mouse CD26 Antibody *H194-112*

Sign In for Pricing
View Details