Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Rabbit Polyclonal Antibody (HRP)

UCHL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NDGOA, PARK5, PGP95, SPG79, PGP9.5, Uch-L1, HEL-117, PGP 9.5, HEL-S-53

UniProt

P09936

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UCHL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004172

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHSY1 HDR Plasmid (h)
sc-405999-HDR 20 µg

CHSY1 HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human LMO7 Protein
E30P03681A 50 µg

Recombinant Human LMO7 Protein

Sign In for Pricing
View Details
PPP1R9B, NT (PPP1R9B, PPP1R6, Neurabin-2, Protein phosphatase 1 regulatory subunit 9B, Spinophilin, Neurabin-II) (MaxLight 750)
MBS6336619-01 0.1 mL

PPP1R9B, NT (PPP1R9B, PPP1R6, Neurabin-2, Protein phosphatase 1 regulatory subunit 9B, Spinophilin, Neurabin-II) (MaxLight 750)

Sign In for Pricing
View Details
PPP1R9B, NT (PPP1R9B, PPP1R6, Neurabin-2, Protein phosphatase 1 regulatory subunit 9B, Spinophilin, Neurabin-II) (MaxLight 750)
MBS6336619-02 5x 0.1 mL

PPP1R9B, NT (PPP1R9B, PPP1R6, Neurabin-2, Protein phosphatase 1 regulatory subunit 9B, Spinophilin, Neurabin-II) (MaxLight 750)

Sign In for Pricing
View Details
Rat Phospholipid scramblase 1 (PLSCR1) ELISA Kit
MBS2805878-01 48 Tests

Rat Phospholipid scramblase 1 (PLSCR1) ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipid scramblase 1 (PLSCR1) ELISA Kit
MBS2805878-02 96 Tests

Rat Phospholipid scramblase 1 (PLSCR1) ELISA Kit

Sign In for Pricing
View Details