Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL7R Rabbit Polyclonal Antibody (HRP)

IL7R Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ILRA, CD127, IL7RA, CDW127, IL-7R-alpha

UniProt

P16871

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL7R

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCP

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_002176

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H1f1 (NM_030609) Mouse Untagged Clone
MC211927 10 µg

H1f1 (NM_030609) Mouse Untagged Clone

Sign In for Pricing
View Details
Goat Lipid Phosphate Phosphohydrolase 2 (PPAP2C) ELISA Kit
MBS9915860 Inquire

Goat Lipid Phosphate Phosphohydrolase 2 (PPAP2C) ELISA Kit

Sign In for Pricing
View Details
801-D Cell Line
RWT-936 1x 10^6

801-D Cell Line

Sign In for Pricing
View Details
Phospho-CDC37 (Ser13) BioAssayTM ELISA Kit
472934 2x 96 Tests

Phospho-CDC37 (Ser13) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
2'-Deoxy-5-methylcytidine-5'-triphosphate sodium salt - 10 mM aqueous solution
ND71642-01 250 µg

2'-Deoxy-5-methylcytidine-5'-triphosphate sodium salt - 10 mM aqueous solution

Sign In for Pricing
View Details
2'-Deoxy-5-methylcytidine-5'-triphosphate sodium salt - 10 mM aqueous solution
ND71642-02 500 µg

2'-Deoxy-5-methylcytidine-5'-triphosphate sodium salt - 10 mM aqueous solution

Sign In for Pricing
View Details