Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP3 Rabbit Polyclonal Antibody (HRP)

TIMP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SFD, K222, K222TA2, HSMRK222

UniProt

P35625

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TIMP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000353

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986UR-01 25 µg

Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986UR-02 100 µg

Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Chromogranin A (CHGA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D7]
TA506119BM 100 µL

Chromogranin A (CHGA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D7]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS504570 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Adenosine 3′-Phosphate 5′-Phosphosulfate Lithium Salt Hydrate (Technical Grade)
TRC-A109435-2.5MG 2.5 mg

Adenosine 3′-Phosphate 5′-Phosphosulfate Lithium Salt Hydrate (Technical Grade)

Sign In for Pricing
View Details
Human ZNF98 activation kit by CRISPRa
GA115657 1 Kit

Human ZNF98 activation kit by CRISPRa

Sign In for Pricing
View Details