Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIMP2 Rabbit Polyclonal Antibody (HRP)

AIMP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P38, JTV1, HLD17, JTV-1

UniProt

Q13155

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AIMP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006294

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Metal tolerance protein 12 (MTP12)
orb2910456-01 20 µg

Recombinant Arabidopsis thaliana Metal tolerance protein 12 (MTP12)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Metal tolerance protein 12 (MTP12)
orb2910456-02 100 µg

Recombinant Arabidopsis thaliana Metal tolerance protein 12 (MTP12)

Sign In for Pricing
View Details
A-Hydroxy flubromazolam
END23796-01 1 mg

A-Hydroxy flubromazolam

Sign In for Pricing
View Details
A-Hydroxy flubromazolam
END23796-02 2 mg

A-Hydroxy flubromazolam

Sign In for Pricing
View Details
A-Hydroxy flubromazolam
END23796-03 5 mg

A-Hydroxy flubromazolam

Sign In for Pricing
View Details
WIPI1, NT (WIPI1, WIPI49, WD repeat domain phosphoinositide-interacting protein 1, Atg18 protein homolog, WD40 repeat protein interacting with phosphoinositides of 49kD) (MaxLight 550) discontinued
043881-ML550 100 µL

WIPI1, NT (WIPI1, WIPI49, WD repeat domain phosphoinositide-interacting protein 1, Atg18 protein homolog, WD40 repeat protein interacting with phosphoinositides of 49kD) (MaxLight 550) discontinued

Sign In for Pricing
View Details