Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nae1 Rabbit Polyclonal Antibody (HRP)

Nae1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ap, 59kDa, Appbp1

UniProt

Q8VBW6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nae1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RPL34 Antibody
NBP1-81331-25ul 25 µL

Rabbit Polyclonal RPL34 Antibody

Sign In for Pricing
View Details
Rabies (Rabies Virus) (MaxLight 405) discontinued
R0011-01-ML405 100 µL

Rabies (Rabies Virus) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human Histone deacetylase 7 (HDAC7), partial
orb1631453-01 20 µg

Recombinant Human Histone deacetylase 7 (HDAC7), partial

Sign In for Pricing
View Details
Recombinant Human Histone deacetylase 7 (HDAC7), partial
orb1631453-02 100 µg

Recombinant Human Histone deacetylase 7 (HDAC7), partial

Sign In for Pricing
View Details
Recombinant Human Histone deacetylase 7 (HDAC7), partial
orb1631453-03 1 mg

Recombinant Human Histone deacetylase 7 (HDAC7), partial

Sign In for Pricing
View Details
Human PTH Matched Antibody Pair Set [IV11482/Poly]
Z01LS-1122-LS706 5 Plates

Human PTH Matched Antibody Pair Set [IV11482/Poly]

Sign In for Pricing
View Details