Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POFUT1 Rabbit Polyclonal Antibody (FITC)

POFUT1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DDD2, FUT12, O-FUT, OFUCT1, O-Fuc-T, O-FucT-1

UniProt

Q6EV69

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POFUT1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: B-A19]
AM31188AF-N 200 µg

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: B-A19]

Sign In for Pricing
View Details
Human TMPRSS11E activation kit by CRISPRa
GA109188 1 Kit

Human TMPRSS11E activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Rps28 activation kit by CRISPRa
GA205636 1 Kit

Mouse Rps28 activation kit by CRISPRa

Sign In for Pricing
View Details
9930111J21Rik1 Mouse Gene Knockout Kit (CRISPR)
KN500534 1 Kit

9930111J21Rik1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LIMS1 Rabbit Polyclonal Antibody
TA369192 100 µL

LIMS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Smarcb1 Mouse Gene Knockout Kit (CRISPR)
KN316287RB 1 Kit

Smarcb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details