Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADPS2 Rabbit Polyclonal Antibody (Biotin)

CADPS2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAPS2

UniProt

Q86UW7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human CADPS2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001009571.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit
MBS2706816-01 24 Strip Well

Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit

Sign In for Pricing
View Details
Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit
MBS2706816-02 48 Well

Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit

Sign In for Pricing
View Details
Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit
MBS2706816-03 96 Well

Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit

Sign In for Pricing
View Details
Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit
MBS2706816-04 5x 96 Well

Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit

Sign In for Pricing
View Details
Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit
MBS2706816-05 10x 96 Well

Human DnaJ/HSP40 Homolog Subfamily C, Member 12 (DNAJC12) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse H2-M1 shRNA (UAS) - Lentiviral mouse H2-M1 shRNA (UAS, iRFP) (25)
GTR15285650 1 Vial

Lentiviral mouse H2-M1 shRNA (UAS) - Lentiviral mouse H2-M1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details