Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nckipsd Rabbit Polyclonal Antibody (HRP)

Nckipsd Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nckipsd

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEDVIRCYLEELLH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100327

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF7 (E3 Ubiquitin-Protein Ligase TRAF7, TNF Receptor-Associated Factor 7, E3 Ubiquitin Protein Ligase)
494444 100 µL

TRAF7 (E3 Ubiquitin-Protein Ligase TRAF7, TNF Receptor-Associated Factor 7, E3 Ubiquitin Protein Ligase)

Sign In for Pricing
View Details
SOX1 Recombinant Antibody, PerCP Conjugated
bsm-54625R-PerCP-TR 20 µL

SOX1 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
RBMX Blocking Peptide
33R-10408 100 ug

RBMX Blocking Peptide

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans 10 kDa chaperonin (groS)
MBS1309404-01 0.02 mg (E-Coli)

Recombinant Shewanella denitrificans 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans 10 kDa chaperonin (groS)
MBS1309404-02 0.1 mg (E-Coli)

Recombinant Shewanella denitrificans 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Shewanella denitrificans 10 kDa chaperonin (groS)
MBS1309404-03 0.02 mg (Yeast)

Recombinant Shewanella denitrificans 10 kDa chaperonin (groS)

Sign In for Pricing
View Details