Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSR5 Rabbit Polyclonal Antibody (HRP)

SSR5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SS-5-R

UniProt

P35346

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSR5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGC

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

NCBI Accession Number

NP_001044

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAC4 Protein Vector (Rat) (pPM-C-HA)
PV309472 500 ng

TAC4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Monkey High Density Lipoprotein 3 ELISA Kit
MBS7262853-01 48 Well

Monkey High Density Lipoprotein 3 ELISA Kit

Sign In for Pricing
View Details
Monkey High Density Lipoprotein 3 ELISA Kit
MBS7262853-02 96 Well

Monkey High Density Lipoprotein 3 ELISA Kit

Sign In for Pricing
View Details
Monkey High Density Lipoprotein 3 ELISA Kit
MBS7262853-03 5x 96 Well

Monkey High Density Lipoprotein 3 ELISA Kit

Sign In for Pricing
View Details
Monkey High Density Lipoprotein 3 ELISA Kit
MBS7262853-04 10x 96 Well

Monkey High Density Lipoprotein 3 ELISA Kit

Sign In for Pricing
View Details
Ddhd2 Rat Pre-designed siRNA Set A
HY-RS27421 1 Set

Ddhd2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details