Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB4B Rabbit Polyclonal Antibody (HRP)

RAB4B Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P61018

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RAB4B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 4-methyl-6-oxo-1,6-dihydropyridine-3-carboxylate
ZYB46502 2.5 g

Methyl 4-methyl-6-oxo-1,6-dihydropyridine-3-carboxylate

Sign In for Pricing
View Details
P53 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-8687R-BF750-01 20 µL

P53 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
P53 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-8687R-BF750-02 100 µL

P53 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
SCRN3 Protein Vector (Mouse) (pPM-C-HA)
PV227156 500 ng

SCRN3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Bhlhe23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6635608 1.0 µg DNA

Bhlhe23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Anti-Mouse CD23/FCER2 Polyclonal Antibody
MY541014-01 50 µg

Anti-Mouse CD23/FCER2 Polyclonal Antibody

Sign In for Pricing
View Details