Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Opn3 Rabbit Polyclonal Antibody (HRP)

Opn3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E, Ec, ERO, Ecpn

UniProt

Q9WUK7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AESEMHIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Host cell factor C1 regULator 1 (HCFC1R1) activation kit by CRISPRa
GA110428 1 Kit

Human Host cell factor C1 regULator 1 (HCFC1R1) activation kit by CRISPRa

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF594 conjugate, 0.1mg/mL
BNC940809-500 1x 500 µL

Cyclin D1 (CCND1/809), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Guanidinoethyl 2-Guanidinoethanethiosulfonate, Dihydrobromide
TRC-G825000-25MG 25 mg

2-Guanidinoethyl 2-Guanidinoethanethiosulfonate, Dihydrobromide

Sign In for Pricing
View Details
Mouse Ccnt1 activation kit by CRISPRa
GA200589 1 Kit

Mouse Ccnt1 activation kit by CRISPRa

Sign In for Pricing
View Details
Uba2 Antibody
8C0383-AAT 50 µg

Uba2 Antibody

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2956), CF594 conjugate, 0.1mg/mL
BNC942956-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2956), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details