Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacna2d4 Rabbit Polyclonal Antibody (HRP)

Cacna2d4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BE686333, 5730412N02Rik

UniProt

F8VPL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DYVHYIEPCFKGILVQADRDNREHFKQLVDELMVKGVGVVSQALIEAFEI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

129kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028554

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein L - 100nm Gold Conjugate
AC-100-19-15 1 mL

Protein L - 100nm Gold Conjugate

Sign In for Pricing
View Details
Monoclonal CR1 / CD35 Antibody (clone E11), Clone: E11
AMM02165G 0.05mg

Monoclonal CR1 / CD35 Antibody (clone E11), Clone: E11

Sign In for Pricing
View Details
Mouse Monoclonal GLP1 Antibody (03) [DyLight 405]
NBP2-21747V 0.1 mL

Mouse Monoclonal GLP1 Antibody (03) [DyLight 405]

Sign In for Pricing
View Details
Mouse Gm20831 (NM_001103152) AAV Particle
MR213838A1V 250 µL

Mouse Gm20831 (NM_001103152) AAV Particle

Sign In for Pricing
View Details
SEC61 beta Rabbit Polyclonal Antibody (BF405)
orb2393304 100 µL

SEC61 beta Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Polyclonal Antibody to Drebrin 1 (DBN1)
TRV-0046042-01 20 µL

Polyclonal Antibody to Drebrin 1 (DBN1)

Sign In for Pricing
View Details