Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr329-ps Rabbit Polyclonal Antibody (Biotin)

Olfr329-ps Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Olfr3, MOR275, MOR275-6P, Olfr329-ps

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVLRMNSAEGRKKALATCSSHMTVVTLFYGAAVYTYMLPASLHTPEKDMV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001011531

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Galectin-12 protein (N-His)
PKSH034187-01 20 µg

Recombinant Human Galectin-12 protein (N-His)

Sign In for Pricing
View Details
Recombinant Human Galectin-12 protein (N-His)
PKSH034187-02 100 µg

Recombinant Human Galectin-12 protein (N-His)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1881), Biotin conjugate, 0.1mg/mL
BNCB1881-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/1881), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSC1 Antibody (phospho-Y297)
F48830-0.08ML 0.08 mL

TSC1 Antibody (phospho-Y297)

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD8 Antibody[UCHT-4]
AN00427P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD8 Antibody[UCHT-4]
AN00427P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details