Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM185A Rabbit Polyclonal Antibody (HRP)

TMEM185A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ee3, FRAXF, FAM11A, CXorf13

UniProt

Q8NFB2

Immunogen

The immunogen for Anti-TMEM185A antibody is: synthetic peptide directed towards the N-terminal region of Human T185A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVF

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115897.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3KBP1 Antibody
CSB-PA160205-01 50 μL

SH3KBP1 Antibody

Sign In for Pricing
View Details
SH3KBP1 Antibody
CSB-PA160205-02 100 µL

SH3KBP1 Antibody

Sign In for Pricing
View Details
Rabbit Hamster albumin Antibody
orb22331 1 mL

Rabbit Hamster albumin Antibody

Sign In for Pricing
View Details
HMGB3P27 Recombinant Protein (Human)
RP062703 100 µg

HMGB3P27 Recombinant Protein (Human)

Sign In for Pricing
View Details
RM 137-15
orb2944057-01 100 mg

RM 137-15

Sign In for Pricing
View Details
RM 137-15
orb2944057-02 50 mg

RM 137-15

Sign In for Pricing
View Details