Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA12 Rabbit Polyclonal Antibody (HRP)

MAGEA12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT1.12, MAGE12

UniProt

P43365

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_005358

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCAR2 Antibody
MBS9434800-01 0.1 mL

CCAR2 Antibody

Sign In for Pricing
View Details
CCAR2 Antibody
MBS9434800-02 5x 0.1 mL

CCAR2 Antibody

Sign In for Pricing
View Details
TCEB1, Recombinant, Human, aa1-112, GST-Tag (Transcription Elongation Factor B Polypeptide 1)
375506-01 20 µg

TCEB1, Recombinant, Human, aa1-112, GST-Tag (Transcription Elongation Factor B Polypeptide 1)

Sign In for Pricing
View Details
TCEB1, Recombinant, Human, aa1-112, GST-Tag (Transcription Elongation Factor B Polypeptide 1)
375506-02 100 µg

TCEB1, Recombinant, Human, aa1-112, GST-Tag (Transcription Elongation Factor B Polypeptide 1)

Sign In for Pricing
View Details
TCEB1, Recombinant, Human, aa1-112, GST-Tag (Transcription Elongation Factor B Polypeptide 1)
375506-03 1 mg

TCEB1, Recombinant, Human, aa1-112, GST-Tag (Transcription Elongation Factor B Polypeptide 1)

Sign In for Pricing
View Details
Recombinant Inter Alpha-Globulin Inhibitor H4 (ITIH4)
TRV-0012284-01 10 µg

Recombinant Inter Alpha-Globulin Inhibitor H4 (ITIH4)

Sign In for Pricing
View Details