Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Carbonic anhydrase 2 (Ca2)

Product Specifications

Product Name Alternative

(Carbonate dehydratase II) (Carbonic anhydrase II) (CA-II)

Abbreviation

Recombinant Rat Ca2 protein

Gene Name

Ca2

UniProt

P27139

Expression Region

2-260aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SHHWGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVASKSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELMVDNWRPAQPLKNRKIKASFK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Essential for bone resorption and osteoclast differentiation. Reversible hydration of carbon dioxide. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.7 kDa

References & Citations

"Carbonic anhydrase II plays a major role in osteoclast differentiation and bone resorption by effecting the steady state intracellular pH and Ca2+." Lehenkari P., Hentunen T.A., Laitala-Leinonen T., Tuukkanen J., Vaeaenaenen H.K. Exp. Cell Res. 242:128-137 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arl3 Mouse Gene Knockout Kit (CRISPR)
KN501571 1 Kit

Arl3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
G2A (GPR132) Rabbit Polyclonal Antibody
AP01208PU-N 100 µg

G2A (GPR132) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF568 conjugate, 0.1mg/mL
BNC681791-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1791), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat COL2 (Collagen Type II) CLIA Kit
E-CL-R0160-01 24 Tests

Rat COL2 (Collagen Type II) CLIA Kit

Sign In for Pricing
View Details
Rat COL2 (Collagen Type II) CLIA Kit
E-CL-R0160-02 48 Tests

Rat COL2 (Collagen Type II) CLIA Kit

Sign In for Pricing
View Details
Rat COL2 (Collagen Type II) CLIA Kit
E-CL-R0160-03 96 Tests

Rat COL2 (Collagen Type II) CLIA Kit

Sign In for Pricing
View Details